PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00025263-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family ZF-HD
Protein Properties Length: 103aa    MW: 10947 Da    PI: 8.0003
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00025263-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer101.46e-323187360
            ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
                           +vrY eC+kNhAa++Gg+avDGC+Efmp  geegta al+CaACgCHRnFHRreve e
  SMil_00025263-RA_Salv 31 AVRYGECQKNHAANVGGYAVDGCREFMPC-GEEGTAGALTCAACGCHRNFHRREVEGE 87
                           79**************************9.999*********************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257746.0E-17198IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.1E-293284IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.4E-263384IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.6793483IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 103 aa     Download sequence    Send to blast
MKKRQVVFKR GGDQGHHQSS NSANSSYAVR AVRYGECQKN HAANVGGYAV DGCREFMPCG  60
EEGTAGALTC AACGCHRNFH RREVEGEMAA CDCASSPTSS SNT
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011098624.13e-45PREDICTED: mini zinc finger protein 2
RefseqXP_011098623.13e-45PREDICTED: mini zinc finger protein 2
SwissprotQ9LJW51e-36MIF2_ARATH; Mini zinc finger protein 2
TrEMBLS8D4122e-42S8D412_9LAMI; Uncharacterized protein (Fragment)
STRINGVIT_14s0108g00810.t015e-40(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11052486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28917.12e-24mini zinc finger 2